SCOPe 2.05: Domain d1qagb1: 1qag B:31-151

Lineage for d1qagb1 (1qag B:31-151)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Utrophin [47582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)

8. Domain d1qagb1: 1qag B:31-151 [17402]

Details for d1qagb1

PDB Entry: 1qag, 3 Å

PDB Description: Actin binding region of the dystrophin homologue utrophin

PDB Compounds: (B:) utrophin actin binding region

SCOPe Domain Sequences for d1qagb1:

Sequence; same for both SEQRES and ATOM records:

>d1qagb1 a.40.1.1 (B:31-151) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
dvqkktftkwinarfsksgkppindmftdlkdgrklldllegltgtslpkergstrvhal
nnvnrvlqvlhqnnvelvniggtdivdgnhkltlgllwsiilhwqvkdvmkdvmsdlqqt
n

Timeline for d1qagb1:

• d1qagb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qagb1 appears in SCOPe 2.04
  
• d1qagb1 appears in SCOPe 2.06
  
• d1qagb1 appears in the current release, SCOPe 2.08