SCOPe 2.07: Domain d3djqb_: 3djq B:

Lineage for d3djqb_ (3djq B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d3djqb_: 3djq B: [174002]
   automated match to d11baa_
   complexed with udp

Details for d3djqb_

PDB Entry: 3djq, 1.53 Å

PDB Description: bovine seminal ribonuclease- uridine 5' diphosphate complex

PDB Compounds: (B:) Seminal ribonuclease

SCOPe Domain Sequences for d3djqb_:

Sequence; same for both SEQRES and ATOM records:

>d3djqb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d3djqb_:

• d3djqb_ first appeared in SCOPe 2.01
  
• d3djqb_ appears in SCOPe 2.06