Lineage for d1bhdb_ (1bhd B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. Protein Utrophin [47582] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)
  8. Domain d1bhdb_: 1bhd B: [17399]
    second CH domain

Details for d1bhdb_

PDB Entry: 1bhd (more details), 2 Å

PDB Description: second calponin homology domain from utrophin
PDB Compounds: (B:) utrophin

SCOPe Domain Sequences for d1bhdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhdb_ a.40.1.1 (B:) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
nsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspier
lehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpqqv

SCOPe Domain Coordinates for d1bhdb_ are not available.

Timeline for d1bhdb_:

Domains from other chains:
(mouse over for more information)
d1bhda_