Lineage for d3djfc_ (3djf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2888878Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (46 PDB entries)
  8. 2888930Domain d3djfc_: 3djf C: [173986]
    automated match to d1a9oa_
    complexed with bc3, dms, so4

Details for d3djfc_

PDB Entry: 3djf (more details), 2.3 Å

PDB Description: Crystal Structure of Schistosoma mansoni Purine Nucleoside Phosphorylase in a complex with BCX-34
PDB Compounds: (C:) purine-nucleoside phosphorylase

SCOPe Domain Sequences for d3djfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3djfc_ c.56.2.0 (C:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsv
vghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggln
rslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeen
gfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslv
tnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd

SCOPe Domain Coordinates for d3djfc_:

Click to download the PDB-style file with coordinates for d3djfc_.
(The format of our PDB-style files is described here.)

Timeline for d3djfc_: