| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (26 species) not a true protein |
| Species Vipera ammodytes [TaxId:8705] [188519] (3 PDB entries) |
| Domain d3diha_: 3dih A: [173980] automated match to d1cl5a_ |
PDB Entry: 3dih (more details), 2.6 Å
SCOPe Domain Sequences for d3diha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3diha_ a.133.1.2 (A:) automated matches {Vipera ammodytes [TaxId: 8705]}
sviefgkmiqeetdknpltsysfygchcglgnkgkpkdatdrccfvhsccyaklsdcspk
tnryeyhrengaivcgsstpckkqicecdraaaicfrenlktynkkykvylrfkckgvse
kc
Timeline for d3diha_: