Lineage for d3diha_ (3dih A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015999Protein automated matches [190139] (26 species)
    not a true protein
  7. 2016167Species Vipera ammodytes [TaxId:8705] [188519] (3 PDB entries)
  8. 2016170Domain d3diha_: 3dih A: [173980]
    automated match to d1cl5a_

Details for d3diha_

PDB Entry: 3dih (more details), 2.6 Å

PDB Description: Crystal structure of ammodytin L
PDB Compounds: (A:) Phospholipase A2 homolog, ammodytin L

SCOPe Domain Sequences for d3diha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3diha_ a.133.1.2 (A:) automated matches {Vipera ammodytes [TaxId: 8705]}
sviefgkmiqeetdknpltsysfygchcglgnkgkpkdatdrccfvhsccyaklsdcspk
tnryeyhrengaivcgsstpckkqicecdraaaicfrenlktynkkykvylrfkckgvse
kc

SCOPe Domain Coordinates for d3diha_:

Click to download the PDB-style file with coordinates for d3diha_.
(The format of our PDB-style files is described here.)

Timeline for d3diha_: