SCOPe 2.01: Domain d3diha_: 3dih A:

Lineage for d3diha_ (3dih A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)

6. Protein automated matches [190139] (19 species)
   not a true protein

7. Species Vipera ammodytes [TaxId:8705] [188519] (3 PDB entries)

8. Domain d3diha_: 3dih A: [173980]
   automated match to d1cl5a_

Details for d3diha_

PDB Entry: 3dih, 2.6 Å

PDB Description: Crystal structure of ammodytin L

PDB Compounds: (A:) Phospholipase A2 homolog, ammodytin L

SCOPe Domain Sequences for d3diha_:

Sequence; same for both SEQRES and ATOM records:

>d3diha_ a.133.1.2 (A:) automated matches {Vipera ammodytes [TaxId: 8705]}
sviefgkmiqeetdknpltsysfygchcglgnkgkpkdatdrccfvhsccyaklsdcspk
tnryeyhrengaivcgsstpckkqicecdraaaicfrenlktynkkykvylrfkckgvse
kc

Timeline for d3diha_:

• d3diha_ is new in SCOPe 2.01-stable
  
• d3diha_ appears in SCOPe 2.02
  
• d3diha_ appears in the current release, SCOPe 2.08