Lineage for d1bhda_ (1bhd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712080Protein Utrophin [47582] (1 species)
  7. 2712081Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)
  8. 2712082Domain d1bhda_: 1bhd A: [17398]
    second CH domain

Details for d1bhda_

PDB Entry: 1bhd (more details), 2 Å

PDB Description: second calponin homology domain from utrophin
PDB Compounds: (A:) utrophin

SCOPe Domain Sequences for d1bhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
lqqtnsekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkms
pierlehafskaqtylgieklldpedvavrlpdkksiimyltslfevl

SCOPe Domain Coordinates for d1bhda_:

Click to download the PDB-style file with coordinates for d1bhda_.
(The format of our PDB-style files is described here.)

Timeline for d1bhda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bhdb_