Lineage for d3dieb_ (3die B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852681Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries)
  8. 1852683Domain d3dieb_: 3die B: [173979]
    automated match to d1nswa_
    complexed with cd, fe; mutant

Details for d3dieb_

PDB Entry: 3die (more details), 1.85 Å

PDB Description: domain swapping of staphylococcus aureus thioredoxin w28a mutant
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d3dieb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dieb_ c.47.1.1 (B:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
shmaivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvd
enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl

SCOPe Domain Coordinates for d3dieb_:

Click to download the PDB-style file with coordinates for d3dieb_.
(The format of our PDB-style files is described here.)

Timeline for d3dieb_: