Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (15 species) |
Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries) |
Domain d3dieb_: 3die B: [173979] automated match to d1nswa_ complexed with cd, fe; mutant |
PDB Entry: 3die (more details), 1.85 Å
SCOPe Domain Sequences for d3dieb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dieb_ c.47.1.1 (B:) Thioredoxin {Staphylococcus aureus [TaxId: 1280]} shmaivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvd enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
Timeline for d3dieb_: