| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thioredoxin [52835] (16 species) |
| Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries) |
| Domain d3dieb1: 3die B:1-104 [173979] Other proteins in same PDB: d3diea2, d3dieb2 automated match to d1nswa_ complexed with cd, fe; mutant |
PDB Entry: 3die (more details), 1.85 Å
SCOPe Domain Sequences for d3dieb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dieb1 c.47.1.1 (B:1-104) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
maivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvden
pstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
Timeline for d3dieb1: