Lineage for d3dieb1 (3die B:1-104)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876419Species Staphylococcus aureus [TaxId:1280] [187358] (5 PDB entries)
  8. 2876421Domain d3dieb1: 3die B:1-104 [173979]
    Other proteins in same PDB: d3diea2, d3dieb2
    automated match to d1nswa_
    complexed with cd, fe; mutant

Details for d3dieb1

PDB Entry: 3die (more details), 1.85 Å

PDB Description: domain swapping of staphylococcus aureus thioredoxin w28a mutant
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d3dieb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dieb1 c.47.1.1 (B:1-104) Thioredoxin {Staphylococcus aureus [TaxId: 1280]}
maivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvden
pstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl

SCOPe Domain Coordinates for d3dieb1:

Click to download the PDB-style file with coordinates for d3dieb1.
(The format of our PDB-style files is described here.)

Timeline for d3dieb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dieb2