SCOPe 2.03: Domain d3di1b_: 3di1 B:

Lineage for d3di1b_ (3di1 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [188553] (2 PDB entries)

8. Domain d3di1b_: 3di1 B: [173972]
   automated match to d1o5ka_
   complexed with pyr

Details for d3di1b_

PDB Entry: 3di1, 2.2 Å

PDB Description: Crystal structure of the Staphylococcus aureus Dihydrodipicolinate synthase-pyruvate complex

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3di1b_:

Sequence; same for both SEQRES and ATOM records:

>d3di1b_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mthlfegvgvalttpftnnkvniealkthvnfllennaqaiivngttaesptlttdeker
ilktvidlvdkrvpviagtgtndteksiqasiqakalgadaimlitpyynktnqrglvkh
feaiadavklpvvlynvpsrtnmtiepetveilsqhpyivalkdatndfeyleevkkrid
tnsfalysgnddnvveyyqrggqgvisvianvipkefqalydaqqsgldiqdqfkpigtl
lsalsvdinpipikaltsylgfgnyelrlplvsledtdtkvlretydtfka

Timeline for d3di1b_:

• d3di1b_ first appeared in SCOPe 2.01
  
• d3di1b_ appears in SCOPe 2.02
  
• d3di1b_ appears in SCOPe 2.04
  
• d3di1b_ appears in the current release, SCOPe 2.08