SCOPe 2.06: Domain d1aoaa2: 1aoa A:260-375

Lineage for d1aoaa2 (1aoa A:260-375)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Fimbrin (Plastin), actin-crosslinking domain [47580] (3 species)
   duplication: tandem repeat of four CH domains

7. Species Human (Homo sapiens) [TaxId:9606] [47581] (2 PDB entries)
   Uniprot P13797 121-375, 517-627

8. Domain d1aoaa2: 1aoa A:260-375 [17397]

Details for d1aoaa2

PDB Entry: 1aoa, 2.4 Å

PDB Description: n-terminal actin-crosslinking domain from human fimbrin

PDB Compounds: (A:) t-fimbrin

SCOPe Domain Sequences for d1aoaa2:

Sequence; same for both SEQRES and ATOM records:

>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]}
tleelmklspeelllrwanfhlensgwqkinnfsadikdskayfhllnqiapkgqkegep
ridinmsgfnetddlkraesmlqqadklgcrqfvtpadvvsgnpklnlafvanlfn

Timeline for d1aoaa2:

• d1aoaa2 first appeared (with stable ids) in SCOP 1.55, called d1aoa_2
  
• d1aoaa2 appears in SCOPe 2.05
  
• d1aoaa2 appears in SCOPe 2.07
  
• d1aoaa2 appears in the current release, SCOPe 2.08