Lineage for d3dhtb_ (3dht B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475300Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries)
  8. 1475306Domain d3dhtb_: 3dht B: [173968]
    automated match to d1jebd_
    complexed with hem

Details for d3dhtb_

PDB Entry: 3dht (more details), 2.98 Å

PDB Description: the crystal structure determination of rat (rattus norvegicus) hemoglobin
PDB Compounds: (B:) Hemoglobin subunit beta-1

SCOPe Domain Sequences for d3dhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhtb_ a.1.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vhltdaekaavnglwgkvnpddvggealgrllvvypwtqryfdsfgdlssasaimgnpkv
kahgkkvinafndglkhldnlkgtfahlselhcdklhvdpenfrllgnmivivlghhlgk
eftpcaqaafqkvvagvasalahky

SCOPe Domain Coordinates for d3dhtb_:

Click to download the PDB-style file with coordinates for d3dhtb_.
(The format of our PDB-style files is described here.)

Timeline for d3dhtb_: