Lineage for d3dhrg_ (3dhr G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717928Species Domestic pigeon (Columba livia) [TaxId:8932] [188616] (2 PDB entries)
  8. 1717939Domain d3dhrg_: 3dhr G: [173965]
    automated match to d1fawa_
    complexed with hem

Details for d3dhrg_

PDB Entry: 3dhr (more details), 2 Å

PDB Description: crystal structure determination of methemoglobin from pigeon at 2 angstrom resolution (columba livia)
PDB Compounds: (G:) Hemoglobin subunit alpha-A

SCOPe Domain Sequences for d3dhrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhrg_ a.1.1.2 (G:) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]}
vlsandksnvkavfakiggqagdlggealerlfitypqtktyfphfdlshgsaqikghgk
kvaealveaanhiddiagalsklsdlhaqklrvdpvnfkllghcflvvvavhfpslltpe
vhasldkfvlavgtvltakyr

SCOPe Domain Coordinates for d3dhrg_:

Click to download the PDB-style file with coordinates for d3dhrg_.
(The format of our PDB-style files is described here.)

Timeline for d3dhrg_: