Lineage for d1aa2a_ (1aa2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712035Protein beta-spectrin [47578] (1 species)
  7. 2712036Species Human (Homo sapiens) [TaxId:9606] [47579] (2 PDB entries)
  8. 2712038Domain d1aa2a_: 1aa2 A: [17395]
    CASP2

Details for d1aa2a_

PDB Entry: 1aa2 (more details), 2 Å

PDB Description: calponin homology (ch) domain from human beta-spectrin
PDB Compounds: (A:) beta-spectrin

SCOPe Domain Sequences for d1aa2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa2a_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]}
ksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm

SCOPe Domain Coordinates for d1aa2a_:

Click to download the PDB-style file with coordinates for d1aa2a_.
(The format of our PDB-style files is described here.)

Timeline for d1aa2a_: