Lineage for d3dhic_ (3dhi C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935136Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2935158Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2935159Protein automated matches [190991] (1 species)
    not a true protein
  7. 2935160Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)
  8. 2935167Domain d3dhic_: 3dhi C: [173948]
    Other proteins in same PDB: d3dhia_, d3dhie_
    automated match to d1t0rc_
    complexed with 1pe, act, btb, fe

Details for d3dhic_

PDB Entry: 3dhi (more details), 1.68 Å

PDB Description: crystal structure of reduced toluene 4-monoxygenase hydroxylase complexed with effector protein
PDB Compounds: (C:) toluene 4-monooxygenase hydroxylase gamma subunit

SCOPe Domain Sequences for d3dhic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhic_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfe

SCOPe Domain Coordinates for d3dhic_:

Click to download the PDB-style file with coordinates for d3dhic_.
(The format of our PDB-style files is described here.)

Timeline for d3dhic_: