Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (9 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188695] (16 PDB entries) |
Domain d3dhia_: 3dhi A: [173947] Other proteins in same PDB: d3dhic_, d3dhie_ automated match to d1t0qa_ complexed with 1pe, act, btb, fe |
PDB Entry: 3dhi (more details), 1.68 Å
SCOPe Domain Sequences for d3dhia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhia_ a.25.1.2 (A:) automated matches {Pseudomonas mendocina [TaxId: 300]} amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk dahdfawadkckpamkks
Timeline for d3dhia_: