Lineage for d3dhhe_ (3dhh E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041439Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 1041440Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 1041441Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 1041450Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 1041451Species Pseudomonas mendocina [TaxId:300] [64395] (14 PDB entries)
  8. 1041459Domain d3dhhe_: 3dhh E: [173946]
    Other proteins in same PDB: d3dhha_, d3dhhc_
    automated match to d1g10a_
    complexed with 1pe, bml, btb, cl, fe

Details for d3dhhe_

PDB Entry: 3dhh (more details), 1.94 Å

PDB Description: crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
PDB Compounds: (E:) Toluene-4-monooxygenase system effector protein

SCOPe Domain Sequences for d3dhhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhhe_ d.137.1.1 (E:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d3dhhe_:

Click to download the PDB-style file with coordinates for d3dhhe_.
(The format of our PDB-style files is described here.)

Timeline for d3dhhe_: