SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dhhc_ (3dhh C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160960Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2160982Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 2160983Protein automated matches [190991] (1 species)
    not a true protein
  7. 2160984Species Pseudomonas mendocina [TaxId:300] [188696] (16 PDB entries)
  8. 2160997Domain d3dhhc_: 3dhh C: [173945]
    Other proteins in same PDB: d3dhha_, d3dhhe_
    automated match to d1t0rc_
    complexed with 1pe, bml, btb, cl, fe

Details for d3dhhc_

PDB Entry: 3dhh (more details), 1.94 Å

PDB Description: Crystal Structure of Resting State Toluene 4-Monoxygenase Hydroxylase Complexed with Effector Protein
PDB Compounds: (C:) toluene 4-monooxygenase hydroxylase gamma subunit

SCOPe Domain Sequences for d3dhhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhhc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d3dhhc_:

Click to download the PDB-style file with coordinates for d3dhhc_.
(The format of our PDB-style files is described here.)

Timeline for d3dhhc_: