Lineage for d1bkra_ (1bkr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3533Fold a.40: Calponin-homology domain, CH-domain [47575] (1 superfamily)
  4. 3534Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 3535Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (4 proteins)
  6. 3536Protein beta-spectrin [47578] (1 species)
  7. 3537Species Human (Homo sapiens) [TaxId:9606] [47579] (2 PDB entries)
  8. 3538Domain d1bkra_: 1bkr A: [17394]

Details for d1bkra_

PDB Entry: 1bkr (more details), 1.1 Å

PDB Description: calponin homology (ch) domain from human beta-spectrin at 1.1 angstrom resolution

SCOP Domain Sequences for d1bkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens)}
ksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfskm

SCOP Domain Coordinates for d1bkra_:

Click to download the PDB-style file with coordinates for d1bkra_.
(The format of our PDB-style files is described here.)

Timeline for d1bkra_: