SCOPe 2.01: Domain d3dh2c_: 3dh2 C:

Lineage for d3dh2c_ (3dh2 C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (1 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (7 PDB entries)

8. Domain d3dh2c_: 3dh2 C: [173936]
   automated match to d1py3b_
   complexed with 3gp, bgc, so4

Details for d3dh2c_

PDB Entry: 3dh2, 2.25 Å

PDB Description: crystal structure of ribonuclease sa2 with guanosine-3'-cyclophosphate prepared by cocrystallization

PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d3dh2c_:

Sequence; same for both SEQRES and ATOM records:

>d3dh2c_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
pgsndrgtrrvvtggygeqywspdhyatfqeidprc

Timeline for d3dh2c_:

• d3dh2c_ is new in SCOPe 2.01-stable
  
• d3dh2c_ appears in SCOPe 2.02
  
• d3dh2c_ appears in the current release, SCOPe 2.08