| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
| Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
| Protein automated matches [190834] (3 species) not a true protein |
| Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries) |
| Domain d3dh2b_: 3dh2 B: [173935] automated match to d1py3b_ complexed with 3gp, bgc, so4 |
PDB Entry: 3dh2 (more details), 2.25 Å
SCOPe Domain Sequences for d3dh2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dh2b_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc
Timeline for d3dh2b_: