Lineage for d3dh2a_ (3dh2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923990Protein automated matches [190834] (3 species)
    not a true protein
  7. 2923999Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2924020Domain d3dh2a_: 3dh2 A: [173934]
    automated match to d1py3b_
    complexed with 3gp, bgc, so4

Details for d3dh2a_

PDB Entry: 3dh2 (more details), 2.25 Å

PDB Description: crystal structure of ribonuclease sa2 with guanosine-3'-cyclophosphate prepared by cocrystallization
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d3dh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dh2a_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
sndrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d3dh2a_:

Click to download the PDB-style file with coordinates for d3dh2a_.
(The format of our PDB-style files is described here.)

Timeline for d3dh2a_: