Lineage for d3dgyb_ (3dgy B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531160Protein automated matches [190834] (3 species)
    not a true protein
  7. 2531169Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2531182Domain d3dgyb_: 3dgy B: [173932]
    automated match to d1py3b_
    complexed with 2gp, bgc, so4

Details for d3dgyb_

PDB Entry: 3dgy (more details), 1.8 Å

PDB Description: crystal structure of ribonuclease sa2 with guanosine-2'-cyclophosphate
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d3dgyb_:

Sequence, based on SEQRES records: (download)

>d3dgyb_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
tpgsndrgtrrvvtggygeqywspdhyatfqeidprc

Sequence, based on observed residues (ATOM records): (download)

>d3dgyb_ d.1.1.2 (B:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
tpdrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d3dgyb_:

Click to download the PDB-style file with coordinates for d3dgyb_.
(The format of our PDB-style files is described here.)

Timeline for d3dgyb_: