Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Death-associated protein kinase, Dap [75560] (1 species) CaMK group; CAMKI subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75561] (26 PDB entries) Uniprot P53355 2-285 |
Domain d3dgka1: 3dgk A:2-277 [173929] Other proteins in same PDB: d3dgka2 automated match to d1ig1a_ mutant |
PDB Entry: 3dgk (more details), 1.7 Å
SCOPe Domain Sequences for d3dgka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dgka1 d.144.1.7 (A:2-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikp
Timeline for d3dgka1: