Lineage for d3dgka1 (3dgk A:2-277)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219278Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2219279Species Human (Homo sapiens) [TaxId:9606] [75561] (26 PDB entries)
    Uniprot P53355 2-285
  8. 2219283Domain d3dgka1: 3dgk A:2-277 [173929]
    Other proteins in same PDB: d3dgka2
    automated match to d1ig1a_
    mutant

Details for d3dgka1

PDB Entry: 3dgk (more details), 1.7 Å

PDB Description: crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3dgka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgka1 d.144.1.7 (A:2-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d3dgka1:

Click to download the PDB-style file with coordinates for d3dgka1.
(The format of our PDB-style files is described here.)

Timeline for d3dgka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dgka2