SCOPe 2.08: Domain d3dgka1: 3dgk A:2-277

Lineage for d3dgka1 (3dgk A:2-277)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Death-associated protein kinase, Dap [75560] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
   Uniprot P53355 2-285

8. Domain d3dgka1: 3dgk A:2-277 [173929]
   Other proteins in same PDB: d3dgka2
   automated match to d1ig1a_
   mutant

Details for d3dgka1

PDB Entry: 3dgk, 1.7 Å

PDB Description: crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3dgka1:

Sequence; same for both SEQRES and ATOM records:

>d3dgka1 d.144.1.7 (A:2-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

Timeline for d3dgka1:

• d3dgka1 first appeared in SCOPe 2.01, called d3dgka_
  
• d3dgka1 appears in SCOPe 2.07