![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries) |
![]() | Domain d3dgfc_: 3dgf C: [173926] automated match to d1mvoa_ |
PDB Entry: 3dgf (more details), 2 Å
SCOPe Domain Sequences for d3dgfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dgfc_ c.23.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]} skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
Timeline for d3dgfc_: