Lineage for d3dgec_ (3dge C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158378Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1158379Protein automated matches [190131] (17 species)
    not a true protein
  7. 1158428Species Thermotoga maritima [TaxId:2336] [188956] (5 PDB entries)
  8. 1158436Domain d3dgec_: 3dge C: [173924]
    automated match to d1mvoa_
    complexed with adp, cit, so4

Details for d3dgec_

PDB Entry: 3dge (more details), 2.8 Å

PDB Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism
PDB Compounds: (C:) Response regulator

SCOPe Domain Sequences for d3dgec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgec_ c.23.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
ne

SCOPe Domain Coordinates for d3dgec_:

Click to download the PDB-style file with coordinates for d3dgec_.
(The format of our PDB-style files is described here.)

Timeline for d3dgec_: