Lineage for d3dgcm_ (3dgc M:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705886Protein automated matches [190141] (2 species)
    not a true protein
  7. 2705887Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries)
  8. 2705890Domain d3dgcm_: 3dgc M: [173923]
    automated match to d1m4ra_
    complexed with act, cl, ium, u1

Details for d3dgcm_

PDB Entry: 3dgc (more details), 2.5 Å

PDB Description: structure of il-22/il-22r1
PDB Compounds: (M:) Interleukin-22

SCOPe Domain Sequences for d3dgcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgcm_ a.26.1.3 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcrldksnfqqpyitnrtfmlakeasladqntdvrligeklfhgvsmsercylmkqvlqf
tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
geikaigeldllfmslrnaci

SCOPe Domain Coordinates for d3dgcm_:

Click to download the PDB-style file with coordinates for d3dgcm_.
(The format of our PDB-style files is described here.)

Timeline for d3dgcm_: