| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
| Protein automated matches [190141] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries) |
| Domain d3dgcl_: 3dgc L: [173922] automated match to d1m4ra_ complexed with act, cl, ium, u1 |
PDB Entry: 3dgc (more details), 2.5 Å
SCOPe Domain Sequences for d3dgcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dgcl_ a.26.1.3 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hcrldksnfqqpyitnrtfmlakeasladqntdvrligeklfhgvsmsercylmkqvlqf
tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
geikaigeldllfmslrnaci
Timeline for d3dgcl_: