Lineage for d2cpo_1 (2cpo 0-119)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) 
Superfamily a.39.3: Cloroperoxidase [47571] (1 family) 
Family a.39.3.1: Cloroperoxidase [47572] (1 protein) Protein Cloroperoxidase [47573] (1 species) Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (2 PDB entries) 
Domain d2cpo_1: 2cpo 0-119 [17392]
Details for d2cpo_1
PDB Entry: 2cpo (more details), 2.16 Å
PDB Description: chloroperoxidase
SCOP Domain Sequences for d2cpo_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpo_1 a.39.3.1 (0-119) Cloroperoxidase {Fungus (Caldariomyces fumago)}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
SCOP Domain Coordinates for d2cpo_1:
Click to download the PDB-style file with coordinates for d2cpo_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cpo_1:
- d2cpo_1 first appeared (with stable ids) in SCOP 1.55
- d2cpo_1 appears in SCOP 1.59
- d2cpo_1 appears in the current release, SCOPe 2.08, called d2cpoa1
View in 3D
