Lineage for d1cpo_2 (1cpo 120-298)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 538193Superfamily a.39.3: Cloroperoxidase [47571] (1 family) (S)
    duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each
  5. 538194Family a.39.3.1: Cloroperoxidase [47572] (1 protein)
  6. 538195Protein Cloroperoxidase [47573] (1 species)
  7. 538196Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (2 PDB entries)
  8. 538198Domain d1cpo_2: 1cpo 120-298 [17391]
    complexed with arb, hem, man, mn, nag, xys

Details for d1cpo_2

PDB Entry: 1cpo (more details), 1.9 Å

PDB Description: chloroperoxidase

SCOP Domain Sequences for d1cpo_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpo_2 a.39.3.1 (120-298) Cloroperoxidase {Fungus (Caldariomyces fumago)}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd

SCOP Domain Coordinates for d1cpo_2:

Click to download the PDB-style file with coordinates for d1cpo_2.
(The format of our PDB-style files is described here.)

Timeline for d1cpo_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cpo_1