Lineage for d1cpo_2 (1cpo 120-298)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) 
Superfamily a.39.3: Cloroperoxidase [47571] (1 family) 
Family a.39.3.1: Cloroperoxidase [47572] (1 protein) Protein Cloroperoxidase [47573] (1 species) Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (2 PDB entries) 
Domain d1cpo_2: 1cpo 120-298 [17391]
Details for d1cpo_2
PDB Entry: 1cpo (more details), 1.9 Å
PDB Description: chloroperoxidase
SCOP Domain Sequences for d1cpo_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpo_2 a.39.3.1 (120-298) Cloroperoxidase {Fungus (Caldariomyces fumago)}
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd
SCOP Domain Coordinates for d1cpo_2:
Click to download the PDB-style file with coordinates for d1cpo_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cpo_2:
- d1cpo_2 appears in SCOP 1.57
- d1cpo_2 appears in the current release, SCOPe 2.08, called d1cpoa2
View in 3D
