SCOP 1.69: Domain d1cpo_1: 1cpo 0-119

Lineage for d1cpo_1 (1cpo 0-119)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.3: Cloroperoxidase [47571] (1 family)
   duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each

5. Family a.39.3.1: Cloroperoxidase [47572] (1 protein)

6. Protein Cloroperoxidase [47573] (1 species)

7. Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (2 PDB entries)

8. Domain d1cpo_1: 1cpo 0-119 [17390]

Details for d1cpo_1

PDB Entry: 1cpo, 1.9 Å

PDB Description: chloroperoxidase

SCOP Domain Sequences for d1cpo_1:

Sequence; same for both SEQRES and ATOM records:

>d1cpo_1 a.39.3.1 (0-119) Cloroperoxidase {Fungus (Caldariomyces fumago)}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva

Timeline for d1cpo_1:

• d1cpo_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cpo_1 appears in SCOP 1.67
  
• d1cpo_1 appears in SCOP 1.71
  
• d1cpo_1 appears in the current release, SCOPe 2.08, called d1cpoa1