Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.3: Cloroperoxidase [47571] (1 family) duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each |
Family a.39.3.1: Cloroperoxidase [47572] (1 protein) |
Protein Cloroperoxidase [47573] (1 species) |
Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (2 PDB entries) |
Domain d1cpo_1: 1cpo 0-119 [17390] |
PDB Entry: 1cpo (more details), 1.9 Å
SCOP Domain Sequences for d1cpo_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpo_1 a.39.3.1 (0-119) Cloroperoxidase {Fungus (Caldariomyces fumago)} eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
Timeline for d1cpo_1: