Lineage for d1dqeb_ (1dqe B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3515Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) (S)
  5. 3516Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins)
  6. 3517Protein Pheromone binding protein [47569] (1 species)
  7. 3518Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (1 PDB entry)
  8. 3520Domain d1dqeb_: 1dqe B: [17389]

Details for d1dqeb_

PDB Entry: 1dqe (more details), 1.8 Å

PDB Description: bombyx mori pheromone binding protein

SCOP Domain Sequences for d1dqeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqeb_ a.39.2.1 (B:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge

SCOP Domain Coordinates for d1dqeb_:

Click to download the PDB-style file with coordinates for d1dqeb_.
(The format of our PDB-style files is described here.)

Timeline for d1dqeb_: