Lineage for d1dqeb_ (1dqe B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) 
Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) 
Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins) Protein Pheromone binding protein [47569] (1 species) Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (1 PDB entry) 
Domain d1dqeb_: 1dqe B: [17389]
Details for d1dqeb_
PDB Entry: 1dqe (more details), 1.8 Å
PDB Description: bombyx mori pheromone binding protein
SCOP Domain Sequences for d1dqeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqeb_ a.39.2.1 (B:) Pheromone binding protein {Silkworm (Bombyx mori)}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavge
SCOP Domain Coordinates for d1dqeb_:
Click to download the PDB-style file with coordinates for d1dqeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dqeb_:
- d1dqeb_ appears in SCOP 1.57
- d1dqeb_ appears in the current release, SCOPe 2.08
View in 3D
