Lineage for d3dfed_ (3dfe D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907708Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1907709Protein automated matches [190753] (14 species)
    not a true protein
  7. 1907710Species Anabaena variabilis [TaxId:240292] [188517] (1 PDB entry)
  8. 1907714Domain d3dfed_: 3dfe D: [173889]
    automated match to d2cz4a1
    complexed with edo, ipa

Details for d3dfed_

PDB Entry: 3dfe (more details), 2.35 Å

PDB Description: crystal structure of a putative pii-like signaling protein (yp_323533.1) from anabaena variabilis atcc 29413 at 2.35 a resolution
PDB Compounds: (D:) Putative Pii-Like Signaling Protein

SCOPe Domain Sequences for d3dfed_:

Sequence, based on SEQRES records: (download)

>d3dfed_ d.58.5.0 (D:) automated matches {Anabaena variabilis [TaxId: 240292]}
mskranklvivtekvllkkvakiieeagatgytvvdtggkgsrnvrstgkpntsdtdsnv
kfevltenremaekiadqvaikfftdyagiiyiceaevlyg

Sequence, based on observed residues (ATOM records): (download)

>d3dfed_ d.58.5.0 (D:) automated matches {Anabaena variabilis [TaxId: 240292]}
mskranklvivtekvllkkvakiieeagatgytvvdtggsnvkfevltenremaekiadq
vaikfftdyagiiyiceaevlyg

SCOPe Domain Coordinates for d3dfed_:

Click to download the PDB-style file with coordinates for d3dfed_.
(The format of our PDB-style files is described here.)

Timeline for d3dfed_: