Lineage for d3dfcb1 (3dfc B:2-277)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981022Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 2981023Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
    Uniprot P53355 2-285
  8. 2981050Domain d3dfcb1: 3dfc B:2-277 [173885]
    Other proteins in same PDB: d3dfcb2
    automated match to d1ig1a_
    complexed with anp; mutant

Details for d3dfcb1

PDB Entry: 3dfc (more details), 1.9 Å

PDB Description: crystal structure of a glycine-rich loop mutant of the death associated protein kinase catalytic domain with amppnp
PDB Compounds: (B:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3dfcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dfcb1 d.144.1.7 (B:2-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgkfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d3dfcb1:

Click to download the PDB-style file with coordinates for d3dfcb1.
(The format of our PDB-style files is described here.)

Timeline for d3dfcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dfcb2