| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein automated matches [190142] (21 species) not a true protein |
| Species Escherichia coli [TaxId:562] [186867] (3 PDB entries) |
| Domain d3df9b_: 3df9 B: [173884] Other proteins in same PDB: d3df9a2 automated match to d1nc3a_ complexed with df9 |
PDB Entry: 3df9 (more details), 1.95 Å
SCOPe Domain Sequences for d3df9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df9b_ c.56.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
Timeline for d3df9b_: