SCOPe 2.08: Domain d3df8a1: 3df8 A:1-106

Lineage for d3df8a1 (3df8 A:1-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:50339] [188518] (1 PDB entry)

8. Domain d3df8a1: 3df8 A:1-106 [173882]
   Other proteins in same PDB: d3df8a2
   automated match to d1yyva1
   complexed with act

Details for d3df8a1

PDB Entry: 3df8, 1.65 Å

PDB Description: The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1

PDB Compounds: (A:) possible HxlR family transcriptional factor

SCOPe Domain Sequences for d3df8a1:

Sequence; same for both SEQRES and ATOM records:

>d3df8a1 a.4.5.0 (A:1-106) automated matches {Thermoplasma volcanium [TaxId: 50339]}
mlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstilsrr
ikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrn

Timeline for d3df8a1:

• d3df8a1 first appeared in SCOPe 2.01, called d3df8a_
  
• d3df8a1 appears in SCOPe 2.07