SCOPe 2.06: Domain d3dexh_: 3dex H:

Lineage for d3dexh_ (3dex H:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:33903] [188516] (1 PDB entry)

8. Domain d3dexh_: 3dex H: [173881]
   automated match to d2fa8a1

Details for d3dexh_

PDB Entry: 3dex, 2.7 Å

PDB Description: Crystal structure of SAV_2001 protein from Streptomyces avermitilis, Northeast Structural Genomics Consortium Target SvR107.

PDB Compounds: (H:) sav_2001

SCOPe Domain Sequences for d3dexh_:

Sequence; same for both SEQRES and ATOM records:

>d3dexh_ c.47.1.0 (H:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
phthrvqieyctqcrwlpraawlaqellttfeteltelalkpgtggvfvvrvddevvwdr
reqgfpeptavkrlvrdrvapek

Timeline for d3dexh_:

• d3dexh_ first appeared in SCOPe 2.01
  
• d3dexh_ appears in SCOPe 2.05
  
• d3dexh_ appears in SCOPe 2.07
  
• d3dexh_ appears in the current release, SCOPe 2.08