SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dexg_ (3dex G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (157 species)
    not a true protein
  7. 2120057Species Streptomyces avermitilis [TaxId:33903] [188516] (1 PDB entry)
  8. 2120064Domain d3dexg_: 3dex G: [173880]
    automated match to d2fa8a1

Details for d3dexg_

PDB Entry: 3dex (more details), 2.7 Å

PDB Description: Crystal structure of SAV_2001 protein from Streptomyces avermitilis, Northeast Structural Genomics Consortium Target SvR107.
PDB Compounds: (G:) sav_2001

SCOPe Domain Sequences for d3dexg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dexg_ c.47.1.0 (G:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
thrvqieyctqcrwlpraawlaqellttfeteltelalkpgtggvfvvrvddevvwdrre
qgfpeptavkrlvrdrv

SCOPe Domain Coordinates for d3dexg_:

Click to download the PDB-style file with coordinates for d3dexg_.
(The format of our PDB-style files is described here.)

Timeline for d3dexg_: