Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Streptomyces avermitilis [TaxId:33903] [188516] (1 PDB entry) |
Domain d3dexe_: 3dex E: [173878] automated match to d2fa8a1 |
PDB Entry: 3dex (more details), 2.7 Å
SCOPe Domain Sequences for d3dexe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dexe_ c.47.1.0 (E:) automated matches {Streptomyces avermitilis [TaxId: 33903]} hthrvqieyctqcrwlpraawlaqellttfeteltelalkpgtggvfvvrvddevvwdrr eqgfpeptavkrlvrdrva
Timeline for d3dexe_: