Lineage for d3dexc_ (3dex C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 993608Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 993609Protein automated matches [190056] (35 species)
    not a true protein
  7. 993741Species Streptomyces avermitilis [TaxId:33903] [188516] (1 PDB entry)
  8. 993744Domain d3dexc_: 3dex C: [173876]
    automated match to d2fa8a1

Details for d3dexc_

PDB Entry: 3dex (more details), 2.7 Å

PDB Description: Crystal structure of SAV_2001 protein from Streptomyces avermitilis, Northeast Structural Genomics Consortium Target SvR107.
PDB Compounds: (C:) sav_2001

SCOPe Domain Sequences for d3dexc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dexc_ c.47.1.0 (C:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
thrvqieyctqcrwlpraawlaqellttfeteltelalkpgtggvfvvrvddevvwdrre
qgfpeptavkrlvrdrv

SCOPe Domain Coordinates for d3dexc_:

Click to download the PDB-style file with coordinates for d3dexc_.
(The format of our PDB-style files is described here.)

Timeline for d3dexc_: