SCOPe 2.06: Domain d3delf1: 3del F:34-257

Lineage for d3delf1 (3del F:34-257)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [188892] (1 PDB entry)

8. Domain d3delf1: 3del F:34-257 [173871]
   Other proteins in same PDB: d3delb2, d3delc2, d3deld2, d3delf2
   automated match to d1hpbp_

Details for d3delf1

PDB Entry: 3del, 1.92 Å

PDB Description: The structure of CT381, the arginine binding protein from the periplasm Chlamydia trachomatis

PDB Compounds: (F:) Arginine Binding Protein

SCOPe Domain Sequences for d3delf1:

Sequence; same for both SEQRES and ATOM records:

>d3delf1 c.94.1.0 (F:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]}
ekfivgtnatyppfefvdkrgevvgfdidlareisnklgktldvrefsfdalilnlkqhr
idavitgmsitpsrlkeilmipyygeeikhlvlvfkgenkhplpltqyrsvavqtgtyqe
aylqslsevhirsfdstlevlmevmhgkspvavlepsiaqvvlkdfpalstatidlpedq
wvlgygigvasdrpalalkieaavqeirkegvlaeleqkwglnn

Timeline for d3delf1:

• d3delf1 first appeared in SCOPe 2.01, called d3delf_
  
• d3delf1 was called d3delf_ in SCOPe 2.05
  
• d3delf1 appears in SCOPe 2.07
  
• d3delf1 appears in the current release, SCOPe 2.08