Lineage for d3delf1 (3del F:34-257)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915387Species Chlamydia trachomatis [TaxId:813] [188892] (1 PDB entry)
  8. 2915391Domain d3delf1: 3del F:34-257 [173871]
    Other proteins in same PDB: d3delb2, d3delc2, d3deld2, d3delf2
    automated match to d1hpbp_

Details for d3delf1

PDB Entry: 3del (more details), 1.92 Å

PDB Description: The structure of CT381, the arginine binding protein from the periplasm Chlamydia trachomatis
PDB Compounds: (F:) Arginine Binding Protein

SCOPe Domain Sequences for d3delf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3delf1 c.94.1.0 (F:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]}
ekfivgtnatyppfefvdkrgevvgfdidlareisnklgktldvrefsfdalilnlkqhr
idavitgmsitpsrlkeilmipyygeeikhlvlvfkgenkhplpltqyrsvavqtgtyqe
aylqslsevhirsfdstlevlmevmhgkspvavlepsiaqvvlkdfpalstatidlpedq
wvlgygigvasdrpalalkieaavqeirkegvlaeleqkwglnn

SCOPe Domain Coordinates for d3delf1:

Click to download the PDB-style file with coordinates for d3delf1.
(The format of our PDB-style files is described here.)

Timeline for d3delf1: