SCOPe 2.01: Domain d3delb_: 3del B:

Lineage for d3delb_ (3del B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (20 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [188892] (1 PDB entry)

8. Domain d3delb_: 3del B: [173868]
   automated match to d1hpbp_

Details for d3delb_

PDB Entry: 3del, 1.92 Å

PDB Description: The structure of CT381, the arginine binding protein from the periplasm Chlamydia trachomatis

PDB Compounds: (B:) Arginine Binding Protein

SCOPe Domain Sequences for d3delb_:

Sequence; same for both SEQRES and ATOM records:

>d3delb_ c.94.1.0 (B:) automated matches {Chlamydia trachomatis [TaxId: 813]}
ekfivgtnatyppfefvdkrgevvgfdidlareisnklgktldvrefsfdalilnlkqhr
idavitgmsitpsrlkeilmipyygeeikhlvlvfkgenkhplpltqyrsvavqtgtyqe
aylqslsevhirsfdstlevlmevmhgkspvavlepsiaqvvlkdfpalstatidlpedq
wvlgygigvasdrpalalkieaavqeirkegvlaeleqkwglnnlehhhhhh

Timeline for d3delb_:

• d3delb_ is new in SCOPe 2.01-stable
  
• d3delb_ appears in SCOPe 2.02
  
• d3delb_ appears in the current release, SCOPe 2.08, called d3delb1