Lineage for d1c3za_ (1c3z A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) 
Superfamily a.39.2: Insect pheromon/odorant-binding proteins [47565] (1 family) 
Family a.39.2.1: Insect pheromon/odorant-binding proteins [47566] (2 proteins) 
Protein Thp12-carrier protein [47567] (1 species) Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries) 
Domain d1c3za_: 1c3z A: [17386]
Details for d1c3za_
PDB Entry: 1c3z (more details)
PDB Description: thp12-carrier protein from yellow meal worm
SCOP Domain Sequences for d1c3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3za_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor)}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs
SCOP Domain Coordinates for d1c3za_:
Click to download the PDB-style file with coordinates for d1c3za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c3za_:
- d1c3za_ first appeared (with stable ids) in SCOP 1.55
- d1c3za_ appears in SCOP 1.57
- d1c3za_ appears in SCOP 1.61
- d1c3za_ appears in the current release, SCOPe 2.08
View in 3D