| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
| Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
| Protein Thp12-carrier protein [47567] (1 species) |
| Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [47568] (2 PDB entries) |
| Domain d1c3za_: 1c3z A: [17386] |
PDB Entry: 1c3z (more details)
SCOPe Domain Sequences for d1c3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3za_ a.39.2.1 (A:) Thp12-carrier protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
etpreklkqhsdackaesgvseeslnkvrnreevddpklkehafcilkragfidasgefq
ldhiktkfkensehpekvddlvakcavkkdtpqhssadffkcvhdnrs
Timeline for d1c3za_: