SCOPe 2.03: Domain d3de2x_: 3de2 X:

Lineage for d3de2x_ (3de2 X:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (11 species)
   not a true protein

7. Species Engyodontium album [TaxId:37998] [187057] (27 PDB entries)

8. Domain d3de2x_: 3de2 X: [173855]
   automated match to d1bjre_
   complexed with ca

Details for d3de2x_

PDB Entry: 3de2, 2.1 Å

PDB Description: Proteinase K by LB nanotemplate method after the fourth step of high X-Ray dose on ESRF ID23-1 beamline

PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d3de2x_:

Sequence; same for both SEQRES and ATOM records:

>d3de2x_ c.41.1.1 (X:) automated matches {Engyodontium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

Timeline for d3de2x_:

• d3de2x_ first appeared in SCOPe 2.01
  
• d3de2x_ appears in SCOPe 2.02
  
• d3de2x_ appears in SCOPe 2.04
  
• d3de2x_ appears in the current release, SCOPe 2.08