SCOPe 2.07: Domain d3ddta1: 3ddt A:1-45

Lineage for d3ddta1 (3ddt A:1-45)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
   zinc-bound alpha+beta motif

4. Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families)

5. Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)

6. Protein automated matches [190972] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188625] (2 PDB entries)

8. Domain d3ddta1: 3ddt A:1-45 [173847]
   Other proteins in same PDB: d3ddta2, d3ddtb2
   automated match to d2d8ua1
   complexed with zn

Details for d3ddta1

PDB Entry: 3ddt, 1.9 Å

PDB Description: Crystal structure of the B2 box from MuRF1 in dimeric state

PDB Compounds: (A:) E3 ubiquitin-protein ligase TRIM63

SCOPe Domain Sequences for d3ddta1:

Sequence; same for both SEQRES and ATOM records:

>d3ddta1 g.43.1.1 (A:1-45) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshpmckehedekiniycltcevptcsmckvfgihkacevaplqs

Timeline for d3ddta1:

• d3ddta1 first appeared in SCOPe 2.01, called d3ddta_
  
• d3ddta1 appears in SCOPe 2.06
  
• d3ddta1 appears in the current release, SCOPe 2.08