Lineage for d3ddsb_ (3dds B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142110Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 2142114Species Human (Homo sapiens) [TaxId:9606] [53768] (16 PDB entries)
  8. 2142116Domain d3ddsb_: 3dds B: [173846]
    automated match to d1fa9a_
    complexed with 26b, cff, mes, mpd, nbg, plp, po4

Details for d3ddsb_

PDB Entry: 3dds (more details), 1.8 Å

PDB Description: Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK261
PDB Compounds: (B:) Glycogen phosphorylase, liver form

SCOPe Domain Sequences for d3ddsb_:

Sequence, based on SEQRES records: (download)

>d3ddsb_ c.87.1.4 (B:) Glycogen phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
kniaasgkfssdrtikeyaqniwnveps

Sequence, based on observed residues (ATOM records): (download)

>d3ddsb_ c.87.1.4 (B:) Glycogen phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdgdyiqa
vldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstgtvfda
fpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwp
vdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivg
shavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekig
edyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvk
riheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvad
vvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngalt
igtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidng
ffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaas
gkfssdrtikeyaqniwnveps

SCOPe Domain Coordinates for d3ddsb_:

Click to download the PDB-style file with coordinates for d3ddsb_.
(The format of our PDB-style files is described here.)

Timeline for d3ddsb_: